{"product_id":"proteintech-15301-1-ap","title":"Proteintech, 15301-1-AP, NDUFV2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFV2 (15301-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFV2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15301-1-AP targets NDUFV2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue,  rat skeletal muscle tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human prostate cancer tissue, mouse brain tissue,  mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe NDUFV2 gene encodes the 24-kD subunit of the mitochondrial NADH:ubiquinone oxidoreductase (complex I of the respiratory chain). The protein belongs to the complex I 24 kDa subunit family. It is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. NDUFV2 constitutes one genetic risk factor for PD, and the mutation may well be a cause of complex I deficiency in this disease(PMID:9570948).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7559 Product name: Recombinant human NDUFV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC001632 Sequence: MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 24-27 kDa\nGenBank Accession Number: BC001632\nGene Symbol: NDUFV2\nGene ID (NCBI): 4729\nRRID: AB_2149048\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19404\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848214185,"sku":"15301-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15301-1-ap","provider":"Iright","version":"1.0","type":"link"}