{"product_id":"proteintech-15319-1-ap","title":"Proteintech, 15319-1-AP, AP3S2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP3S2 (15319-1-AP) by Proteintech is a Polyclonal antibody targeting AP3S2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15319-1-AP targets AP3S2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, human testis tissue,  mouse ovary tissue,  mouse testis tissue,  rat liver tissue\nPositive IHC detected in: human colon cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP3S2 is a 22-kDa protein that belongs to the adaptor complexes small subunit family. AP3S2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-3 complex is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7565 Product name: Recombinant human AP3S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC002785 Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV Predict reactive species\nFull Name: adaptor-related protein complex 3, sigma 2 subunit\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC002785\nGene Symbol: AP3S2\nGene ID (NCBI): 10239\nRRID: AB_2056644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P59780\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971380905,"sku":"15319-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15319-1-ap","provider":"Iright","version":"1.0","type":"link"}