{"product_id":"proteintech-15320-1-ap","title":"Proteintech, 15320-1-AP, TNFAIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFAIP1 (15320-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15320-1-AP targets TNFAIP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells\nPositive IHC detected in: human placenta tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNFAIP1 was identified as a human gene activated transcriptionally by tumour necrosis factor alpha in endothelial cells. It is encoded by a 3.5-kilobase transcript and its expression is found to be developmentally regulated in a tissue-specific manner. The open reading frame predicts a 316-amino acid sequence rich in charged residues, particularly at the carboxyl terminus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0220 Product name: Recombinant human TNFAIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-239 aa of BC001949 Sequence: ILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKV Predict reactive species\nFull Name: tumor necrosis factor, alpha-induced protein 1 (endothelial)\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC001949\nGene Symbol: TNFAIP1\nGene ID (NCBI): 7126\nRRID: AB_10644288\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13829\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869504688297,"sku":"15320-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15320-1-ap","provider":"Iright","version":"1.0","type":"link"}