{"product_id":"proteintech-15328-1-ap","title":"Proteintech, 15328-1-AP, SFRP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRP4 (15328-1-AP) by Proteintech is a Polyclonal antibody targeting SFRP4 in WB, IP, IHC, ELISA applications with reactivity to human, rat samples\n15328-1-AP targets SFRP4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissue, human skin cancer tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSecreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRP4 functions as a suppressor of tumor growth via inhibition of the Wnt signaling pathway.Downregulation or deletion of SFRP4 has been reported in several cancers and cell lines such as endometrial cancer, ovarian cancer, lung cancer,and others. This antibody got 41-51 kDa and 55 kDa bands in western blotting maybe due to differential posttranslational protein modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6909 Product name: Recombinant human SFRP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-346 aa of BC058911 Sequence: MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV Predict reactive species\nFull Name: secreted frizzled-related protein 4\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 41-51 kDa, 55 kDa\nGenBank Accession Number: BC058911\nGene Symbol: SFRP4\nGene ID (NCBI): 6424\nRRID: AB_2187099\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6FHJ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895072425,"sku":"15328-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15328-1-ap","provider":"Iright","version":"1.0","type":"link"}