{"product_id":"proteintech-15334-1-ap","title":"Proteintech, 15334-1-AP, POLR2F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLR2F (15334-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2F in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15334-1-AP targets POLR2F in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  C6 cells\nPositive IHC detected in: human cervical cancer tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7449 Product name: Recombinant human POLR2F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC003582 Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD Predict reactive species\nFull Name: polymerase (RNA) II (DNA directed) polypeptide F\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC003582\nGene Symbol: POLR2F\nGene ID (NCBI): 5435\nRRID: AB_10858229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61218\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869423620265,"sku":"15334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15334-1-ap","provider":"Iright","version":"1.0","type":"link"}