{"product_id":"proteintech-15403-1-ap","title":"Proteintech, 15403-1-AP, YPEL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YPEL3 (15403-1-AP) by Proteintech is a Polyclonal antibody targeting YPEL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15403-1-AP targets YPEL3 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYPEL3 is part of a five-member family of closely related paralogues: YPEL1-5, which are named in reference to their Drosophila ortholgue. Studies showed shat YPEL3 is regulated by p53 and its encoding protein induces cellular senescence in human tumor and normal cells, indicating that YPEL3 is a p53-dependent, tumor suppressor gene. (PMID:20388804) 15403-1-AP was raised against full length of YPEL3 protein (1-119aa); it can recognize YPEL1-4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7626 Product name: Recombinant human YPEL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC005009 Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD Predict reactive species\nFull Name: yippee-like 3 (Drosophila)\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC005009\nGene Symbol: YPEL3\nGene ID (NCBI): 83719\nRRID: AB_11042587\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61236\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869440921769,"sku":"15403-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15403-1-ap","provider":"Iright","version":"1.0","type":"link"}