{"product_id":"proteintech-15452-1-ap","title":"Proteintech, 15452-1-AP, FA2H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FA2H (15452-1-AP) by Proteintech is a Polyclonal antibody targeting FA2H in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15452-1-AP targets FA2H in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  human stomach tissue,  mouse colon tissue,  MKN-45 cells,  SGC-7901 cells,  mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human colon cancer tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFA2H(Fatty acid 2-hydroxylase) required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. The deduced 372-amino acid protein has a calculated molecular mass of 42.8 kD .Both mouse and human FA2H have a C-terminal endoplasmic reticulum (ER) retention motif(PMID: 15658937).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7717 Product name: Recombinant human FA2H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC002679 Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGL Predict reactive species\nFull Name: fatty acid 2-hydroxylase\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 38-43 kDa\nGenBank Accession Number: BC002679\nGene Symbol: FA2H\nGene ID (NCBI): 79152\nRRID: AB_2101886\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L5A8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924498089,"sku":"15452-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15452-1-ap","provider":"Iright","version":"1.0","type":"link"}