{"product_id":"proteintech-15456-1-ap","title":"Proteintech, 15456-1-AP, NOL12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOL12 (15456-1-AP) by Proteintech is a Polyclonal antibody targeting NOL12 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15456-1-AP targets NOL12 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells,  HepG2 cells,  Raji cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleolar protein 12 (NOL12), a multifunctional RNA-binding protein, has been found to be related to genomic stability, DNA damage repair, and apoptosis. High expression of NOL12 is associated with worse reduced overall survival (OS), high pathological grade, node metastasis, and advanced clinical stage in patients with HCC (PMID: 35693698). Knockdown of NOL12 impairs cellular proliferation by inducing a G1\/S cell cycle arrest, but does so outside of a nucleolar stress response and in a p53-independent manner (PMID: 29069457).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7723 Product name: Recombinant human NOL12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC002808 Sequence: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE Predict reactive species\nFull Name: nucleolar protein 12\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC002808\nGene Symbol: NOL12\nGene ID (NCBI): 79159\nRRID: AB_2282718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869567209641,"sku":"15456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15456-1-ap","provider":"Iright","version":"1.0","type":"link"}