{"product_id":"proteintech-15469-1-ap","title":"Proteintech, 15469-1-AP, CYB5B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYB5B (15469-1-AP) by Proteintech is a Polyclonal antibody targeting CYB5B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15469-1-AP targets CYB5B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse liver tissue,  human liver tissue,  mouse lung tissue,  human adrenal gland tissue,  rat liver tissue,  rat lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYB5B(Cytochrome b5 type B) is also named as CYB5M, OMB5 and belongs to the cytochrome b5 family. It is a 21 kDa membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. This protein is expressed on the plasma membrane of lymphoma cells but not normal lymphocytes, reactive lymphocytes or bone marrow precursor cells(PMID:20100355). The full length protein has a propeptide with 11 amino acids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7771 Product name: Recombinant human CYB5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC004373 Sequence: MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS Predict reactive species\nFull Name: cytochrome b5 type B (outer mitochondrial membrane)\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 20-21 kDa\nGenBank Accession Number: BC004373\nGene Symbol: CYB5B\nGene ID (NCBI): 80777\nRRID: AB_2230349\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43169\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964901033,"sku":"15469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15469-1-ap","provider":"Iright","version":"1.0","type":"link"}