{"product_id":"proteintech-15493-1-ap","title":"Proteintech, 15493-1-AP, Pancreatic Polypeptide Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pancreatic Polypeptide (15493-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n15493-1-AP targets Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat pancreas tissue\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7886 Product name: Recombinant human PPY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC032225 Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL Predict reactive species\nFull Name: pancreatic polypeptide\nCalculated Molecular Weight: 10 kDa\nGenBank Accession Number: BC032225\nGene Symbol: Pancreatic Polypeptide\nGene ID (NCBI): 5539\nRRID: AB_2878145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01298\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869006221481,"sku":"15493-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15493-1-ap","provider":"Iright","version":"1.0","type":"link"}