{"product_id":"proteintech-15511-1-ap","title":"Proteintech, 15511-1-AP, SMU1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMU1 (15511-1-AP) by Proteintech is a Polyclonal antibody targeting SMU1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15511-1-AP targets SMU1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  K-562 cells\nPositive IHC detected in: human kidney tissue,  human brain tissue,  human hepatocirrhosis tissue,  human ovary tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSum1, belongs to the WD repeat SMU1 family. Human SMU1 is a component of the spliceosome fSAP57(PMID: 15254247). It is possible that the mutation in Smu1 affects spliceosome function, resulting in generation of improper splice variants, which could explain the phenotypes of tsTM18 cells. Some results suggest that Smu1 participates in at least two steps of splicing: splice-site choice and control of accuracy(PMID: 17105761). This antibody is a rabbit polyclonal antibody raised against a region of human REDD1 antigen.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7688 Product name: Recombinant human SMU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-513 aa of BC002876 Sequence: ISASSDGTVKIWNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP Predict reactive species\nFull Name: smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans)\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC002876\nGene Symbol: SMU1\nGene ID (NCBI): 55234\nRRID: AB_2270843\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2TAY7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810367657,"sku":"15511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15511-1-ap","provider":"Iright","version":"1.0","type":"link"}