{"product_id":"proteintech-15528-1-ap","title":"Proteintech, 15528-1-AP, CABC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CABC1 (15528-1-AP) by Proteintech is a Polyclonal antibody targeting CABC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15528-1-AP targets CABC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human skeletal muscle tissue,  human heart tissue,  mouse heart tissue,  U-251 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCABC1 (Chaperone, ABC1 activity of bc1 complex homolog) is induced by the tumor suppressor p53 and is similar to the yeast ABC1, which is involved in an electron-transferring membrane protein complex in the respiratory chain. The CABC1 product was located in mitochondria, and may play an important role in mediating p53-inducible apoptosis. Four isoforms of CABC1 exist due to alternative splicing events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7612 Product name: Recombinant human CABC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-647 aa of BC005171 Sequence: VRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ Predict reactive species\nFull Name: chaperone, ABC1 activity of bc1 complex homolog (S. pombe)\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC005171\nGene Symbol: CABC1\nGene ID (NCBI): 56997\nRRID: AB_2066403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NI60\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869396816041,"sku":"15528-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15528-1-ap","provider":"Iright","version":"1.0","type":"link"}