{"product_id":"proteintech-15530-1-ap","title":"Proteintech, 15530-1-AP, DHRS7B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHRS7B (15530-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15530-1-AP targets DHRS7B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  LNCaP cells,  MCF-7 cells,  MDA-MB-231 cells,  PC-3 cells\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHRS7B (Dehydrogenase\/Reductase 7B) is a member of the short-chain dehydrogenase\/reductase (SDR) superfamily, a group of enzymes involved in redox reactions, particularly the metabolism of steroids, lipids, and xenobiotics. DHRS7B is characterized by its NAD(P)H-dependent oxidoreductase activity and plays roles in cellular detoxification, lipid homeostasis, and possibly steroid hormone regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7690 Product name: Recombinant human DHRS7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-325 aa of BC004126 Sequence: ISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS Predict reactive species\nFull Name: dehydrogenase\/reductase (SDR family) member 7B\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC004126\nGene Symbol: DHRS7B\nGene ID (NCBI): 25979\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6IAN0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887186727081,"sku":"15530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15530-1-ap","provider":"Iright","version":"1.0","type":"link"}