{"product_id":"proteintech-15537-1-ap","title":"Proteintech, 15537-1-AP, CSTF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSTF1 (15537-1-AP) by Proteintech is a Polyclonal antibody targeting CSTF1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15537-1-AP targets CSTF1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  A549 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCleavage stimulation factor (CstF) , a heterotrimeric protein with subunits of 77, 64, and 50 kD (CstF-77, -64, and -50), is a polyadenylation factor that helps to specify the site of processing. CstF recognizes the G+U-rich element, a sequence located downstream of the cleavage site. CstF-50 unit interacts with the COOH-terminal domain of the RNAP II largest subunit (CTD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7874 Product name: Recombinant human CSTF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-177 aa of BC007425 Sequence: MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVT Predict reactive species\nFull Name: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC007425\nGene Symbol: CSTF1\nGene ID (NCBI): 1477\nRRID: AB_2261143\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05048\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886916587689,"sku":"15537-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15537-1-ap","provider":"Iright","version":"1.0","type":"link"}