{"product_id":"proteintech-15539-1-ap","title":"Proteintech, 15539-1-AP, Cytokeratin 7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 7 (15539-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 7 in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n15539-1-AP targets Cytokeratin 7 in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat liver tissue,  A431 cells,  mouse liver tissue,  mouse bladder tissue,  HepG2 cells,  mouse lung tissue,  rat bladder tissue,  rat lung tissue\nPositive IHC detected in: human pancreas tissue, human bowen disease,  human breast cancer tissue,  human kidney tissue,  human lung tissue,  human lung cancer tissue,  human ovary tumor tissue,  human stomach cancer tissue,  mouse kidney tissue,  mouse pancreas tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue, rat liver tissue\nPositive IF-Fro detected in: mouse breast cancer\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:30000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytokeratin 7 (CK7) is a type II keratin protein that is a principal constituent of the intermediate filament cytoskeleton. It is primarily expressed in simple epithelia lining the cavities of internal organs, glandular ducts, and blood vessels. Abnormal expression of CK7 has been linked to various pathological conditions, including cancer. Overexpression of CK7 promotes tumor progression and metastasis in different human cancers, and its suppression leads to rapid tumor regression, highlighting its potential as a therapeutic target  CK7 is also involved in inhibiting interferon-dependent interphase, promoting DNA synthesis, initiating translation possibly through interaction with p150 (the largest subunit of eukaryotic translation initiation factor 3), and interacting with G protein-coupled estrogen receptor 1 (GPER1), which activates several signaling pathways. In the context of cancer diagnosis, CK7 is used as a marker to distinguish between different types of carcinomas. It is expressed in most adenocarcinomas, particularly those of the lung and colorectal origin, and is useful in differentiating primary ovarian carcinoma from metastatic colorectal carcinoma. CK7 expression has also been studied as a predictor of an unfavorable prognosis in colorectal carcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7895 Product name: Recombinant human CK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR Predict reactive species\nFull Name: keratin 7\nCalculated Molecular Weight: 469 aa, 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC002700\nGene Symbol: Cytokeratin 7\nGene ID (NCBI): 3855\nRRID: AB_2249769\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08729\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858765481,"sku":"15539-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15539-1-ap","provider":"Iright","version":"1.0","type":"link"}