{"product_id":"proteintech-15550-1-ap","title":"Proteintech, 15550-1-AP, PGAM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGAM2 (15550-1-AP) by Proteintech is a Polyclonal antibody targeting PGAM2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15550-1-AP targets PGAM2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HeLa cells,  mouse skeletal muscle tissue,  rat heart tisssue,  rat skeletal muscle tissue\nPositive IHC detected in: human breast cancer tissue, mouse skeletal muscle tissue,  mouse heart tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphoglycerate mutase (PGAM), an important enzyme in the glycolytic pathway, catalyzes the transfer of a phosphate group between the 2 and the 3 positions of glyceric acid. The muscle-specific isoform (type M, PGAM2) of phosphoglycerate mutase (PGAM) is a housekeeping enzyme and it catalyzes the conversion of 3-phosphoglycerate into 2-phosphoglycerate in the glycolysis process to release energy. It is encoded by the Pgam2 gene. In addition, it is demonstrated that PGAM2 locates both in cytoplasm and nuclei, and takes part in the glycometabolism process of cytoplasm and nuclei(PMID: 18499067). Defects in PGAM2 are the cause of glycogen storage disease type 10 (GSD10). This antibody may also recognize PGAM1 and PGAM4 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7908 Product name: Recombinant human PGAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC001904 Sequence: MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK Predict reactive species\nFull Name: phosphoglycerate mutase 2 (muscle)\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC001904\nGene Symbol: PGAM2\nGene ID (NCBI): 5224\nRRID: AB_2299336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15259\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943798441,"sku":"15550-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15550-1-ap","provider":"Iright","version":"1.0","type":"link"}