{"product_id":"proteintech-15555-1-ap","title":"Proteintech, 15555-1-AP, TRAPPC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAPPC3 (15555-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n15555-1-AP targets TRAPPC3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, PC-3 cells,  HEK-293 cells,  mouse small intestine tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRAPPC3 (trafficking protein particle complex 3, also known as Bet3) is a component of TRAPP, a complex involved in the tethering of transport vesicles to the cis-Golgi membrane. There are three TRAPP complexes identified in yeast with distinct roles: TRAPPI in ER-Golgi traffic, TRAPPII in intra-Golgi and endosome-Golgi traffic, and TRAPPIII in autophagy. Recently it has been proposed that at least two complexes exist in mammals. TRAPPC3 is the most conserved subunit of TRAPP and has been used to precipitate the intact tethering complex both from yeast and from human cells. It has also been reported that TRAPPC3 is required for Rabin8 centrosome trafficking and ciliogenesis. Expressed ubiquitously, TRAPPC3 protein is present in both membrane-bound and cytosolic forms. This antibody recognizes the endogenous 20-22 kDa TRAPPC3 in multiple cell lines. (15728249, 21273506, 23394947)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7924 Product name: Recombinant human TRAPPC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC007662 Sequence: MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE Predict reactive species\nFull Name: trafficking protein particle complex 3\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20-22 kDa\nGenBank Accession Number: BC007662\nGene Symbol: TRAPPC3\nGene ID (NCBI): 27095\nRRID: AB_2208142\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43617\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975026345,"sku":"15555-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15555-1-ap","provider":"Iright","version":"1.0","type":"link"}