{"product_id":"proteintech-15589-1-ap","title":"Proteintech, 15589-1-AP, NDUFB10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB10 (15589-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB10 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15589-1-AP targets NDUFB10 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  human skeletal muscle tissue,  mouse liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human ovary cancer tissue, human brain tissue,  human heart tissue,  human kidney tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB10(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10) is also named as PDSW and belongs to the complex I NDUFB10 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. The Complex I functions in the transfer of electrons from NADH to the respiratory chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7922 Product name: Recombinant human NDUFB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC005829 Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC005829\nGene Symbol: NDUFB10\nGene ID (NCBI): 4716\nRRID: AB_2150790\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O96000\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943143081,"sku":"15589-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15589-1-ap","provider":"Iright","version":"1.0","type":"link"}