{"product_id":"proteintech-15598-1-ap","title":"Proteintech, 15598-1-AP, REXO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REXO2 (15598-1-AP) by Proteintech is a Polyclonal antibody targeting REXO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15598-1-AP targets REXO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  L02 cells\nPositive IHC detected in: human placenta tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7976 Product name: Recombinant human REX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC003502 Sequence: MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT Predict reactive species\nFull Name: REX2, RNA exonuclease 2 homolog (S. cerevisiae)\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC003502\nGene Symbol: REXO2\nGene ID (NCBI): 25996\nRRID: AB_10640529\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3B8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869751988393,"sku":"15598-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15598-1-ap","provider":"Iright","version":"1.0","type":"link"}