{"product_id":"proteintech-15609-1-ap","title":"Proteintech, 15609-1-AP, HAS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HAS3 (15609-1-AP) by Proteintech is a Polyclonal antibody targeting HAS3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15609-1-AP targets HAS3 in WB, FC, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, L02 cells,  mouse liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHAS3(hyaluronan synthase 3) belongs to the NodC\/HAS family, which are widely expressed in human tissues and appear to function in embryogenesis, wound healing and other processes associated with cellular proliferation and migration(PMID:14566823). HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. It may play a role in the progression of colon cancer and, as such, may provide novel targets for diagnostic and therapeutic interventions(PMID:14566823). It has 2 isoforms produced by alternative splicing and the protein has a glycosylation site.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7999 Product name: Recombinant human HAS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-281 aa of BC021853 Sequence: MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ Predict reactive species\nFull Name: hyaluronan synthase 3\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC021853\nGene Symbol: HAS3\nGene ID (NCBI): 3038\nRRID: AB_2232886\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00219\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868967260329,"sku":"15609-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15609-1-ap","provider":"Iright","version":"1.0","type":"link"}