{"product_id":"proteintech-15610-1-ap","title":"Proteintech, 15610-1-AP, CUTA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CUTA (15610-1-AP) by Proteintech is a Polyclonal antibody targeting CUTA in WB, IF\/ICC, ELISA applications with reactivity to human samples\n15610-1-AP targets CUTA in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IMR-32 cells, THP-1 cells\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCUTA also known as ACHAP, functions in cellular copper sensitivity and in the processing and trafficking of membrane proteins. CUTA, the mammalian CutA divalent cation tolerance homolog (E. coli), has been proposed to mediate acetylcholinesterase activity and copper homeostasis. Human CUTA has several variants that differ in N-terminal length and are separated as heavy (H) and light (L) components. The H component of human CUTA was associated with the membrane fraction, whereas the L component of human CUTA was in the cytosol(PMID: 22351782).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8000 Product name: Recombinant human CUTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC005890 Sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP Predict reactive species\nFull Name: cutA divalent cation tolerance homolog (E. coli)\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC005890\nGene Symbol: CUTA\nGene ID (NCBI): 51596\nRRID: AB_3669214\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60888\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886948012201,"sku":"15610-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15610-1-ap","provider":"Iright","version":"1.0","type":"link"}