{"product_id":"proteintech-15614-1-ap","title":"Proteintech, 15614-1-AP, SF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SF4 (15614-1-AP) by Proteintech is a Polyclonal antibody targeting SF4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15614-1-AP targets SF4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse testis tissue\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSF4 (Splicing factor 4), also known as SUGP1 (SURP and G-patch domain-containing protein 1) was first identified as a putative splicing factor based on domain composition analysis. SUGP1 protein is predicted to contain two SURP motifs, domains of alternative splicing regulators thought to be involved in RNA binding, as well as a G-patch domain, a region of six highly conserved glycine residues commonly found in eukaryotic RNA-processing proteins (PMID: 27206982). Research has shown that SUGP1 is involved in the regulation of cholesterol metabolism (PMID: 31474574).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8006 Product name: Recombinant human SF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-348 aa of BC002986 Sequence: LYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY Predict reactive species\nFull Name: splicing factor 4\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 55 kDa, 72 kDa\nGenBank Accession Number: BC002986\nGene Symbol: SF4\nGene ID (NCBI): 57794\nRRID: AB_10859818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWZ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798276265,"sku":"15614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15614-1-ap","provider":"Iright","version":"1.0","type":"link"}