{"product_id":"proteintech-15628-1-ap","title":"Proteintech, 15628-1-AP, EIF4EBP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF4EBP2 (15628-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4EBP2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15628-1-AP targets EIF4EBP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF4EBP2(Eukaryotic translation initiation factor 4E-binding protein 2), also named as 4EBP2, is a member of the eukaryotic translation initiation factor 4E binding protein family. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation. EIF4EBP2 is a repressor of translation initiation involved in synaptic plasticity, learning and memory formation (PubMed:30765518).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8101 Product name: Recombinant human EIF4EBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC005057 Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI Predict reactive species\nFull Name: eukaryotic translation initiation factor 4E binding protein 2\nCalculated Molecular Weight: 120 aa, 13 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC005057\nGene Symbol: EIF4EBP2\nGene ID (NCBI): 1979\nRRID: AB_3669215\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13542\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887490158761,"sku":"15628-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15628-1-ap","provider":"Iright","version":"1.0","type":"link"}