{"product_id":"proteintech-15630-1-ap","title":"Proteintech, 15630-1-AP, NRD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRD1 (15630-1-AP) by Proteintech is a Polyclonal antibody targeting NRD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n15630-1-AP targets NRD1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRD1(Nardilysin) is also named as NRD-C(N-arginine dibasic convertase). It is a zinc metalloendopeptidase of the M16 pitrilysin family that cleaves peptides at dibasic residues. The enzyme has also been found in neural tissues of mouse embryos indicating a role in neural development. Although nardilysin is primarily found in the cytosol, it has been reported that nardilysin is located on the cell surface acting as a receptor for heparinbinding EGF-like growth factor(PMID:15809022). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7923 Product name: Recombinant human NRD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 801-1150 aa of BC008775 Sequence: YFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKALNKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFTTTLNLLPYHKIVK Predict reactive species\nFull Name: nardilysin (N-arginine dibasic convertase)\nCalculated Molecular Weight: 132 kDa\nObserved Molecular Weight: 135-140 kDa\nGenBank Accession Number: BC008775\nGene Symbol: NRD1\nGene ID (NCBI): 4898\nRRID: AB_2154525\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43847\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869477327017,"sku":"15630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15630-1-ap","provider":"Iright","version":"1.0","type":"link"}