{"product_id":"proteintech-15638-1-ap","title":"Proteintech, 15638-1-AP, OPA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPA3 (15638-1-AP) by Proteintech is a Polyclonal antibody targeting OPA3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15638-1-AP targets OPA3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human kidney tissue,  mouse thymus tissue,  Jurkat cells,  HeLa cells,  HEK-293T cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe OPA3 cDNA encodes a deduced 179-amino acid protein. Northern blot analysis demonstrated a primary transcript of approximately 5.0 kb that was ubiquitously expressed, most prominently in skeletal muscle and kidney. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8103 Product name: Recombinant human OPA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-179 aa of BC005059 Sequence: ANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK Predict reactive species\nFull Name: optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)\nCalculated Molecular Weight: 179 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC005059\nGene Symbol: OPA3\nGene ID (NCBI): 80207\nRRID: AB_2158168\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6K4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971225257,"sku":"15638-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15638-1-ap","provider":"Iright","version":"1.0","type":"link"}