{"product_id":"proteintech-15688-1-ap","title":"Proteintech, 15688-1-AP, ERCC6L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERCC6L (15688-1-AP) by Proteintech is a Polyclonal antibody targeting ERCC6L in WB, IHC, ELISA applications with reactivity to human, mouse samples\n15688-1-AP targets ERCC6L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human heart tissue,  Jurkat cells,  mouse lung tissue,  K-562 cells,  U2OS cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERCC6L, also named as Tumor antigen BJ-HCC-15 or PICH, is a 1250 amino acid protein, which contains one helicase ATP-binding domain, one helicase C-terminal domain and two TPR repeats. ERCC6L localizes to kinetochores, inner centromeres and belongs to the SNF2\/RAD54 helicase family. ERCC6L as a DNA helicase that acts as an essential component of the spindle assembly checkpoint. The calculated molecular weight of ERCC6L is 140 kDa, but the phosphorylated modification of molecular weight of ERCC6L is about 180kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8223 Product name: Recombinant human ERCC6L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-454 aa of BC008808 Sequence: NAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN Predict reactive species\nFull Name: excision repair cross-complementing rodent repair deficiency, complementation group 6-like\nCalculated Molecular Weight: 419 aa, 46 kDa, 141 kDa\nObserved Molecular Weight: 180 kDa\nGenBank Accession Number: BC008808\nGene Symbol: ERCC6L\nGene ID (NCBI): 54821\nRRID: AB_2098171\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2NKX8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940751017,"sku":"15688-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15688-1-ap","provider":"Iright","version":"1.0","type":"link"}