{"product_id":"proteintech-15702-1-ap","title":"Proteintech, 15702-1-AP, PCBD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCBD1 (15702-1-AP) by Proteintech is a Polyclonal antibody targeting PCBD1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n15702-1-AP targets PCBD1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue\nPositive IHC detected in: mouse liver tissue, human liver cancer tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCBD1, also known as DCOH and PCBD, belongs to the pterin-4-alpha-carbinolamine dehydratase family. PCBD1 is a bifunctional protein that acts as an enzyme in the regeneration of cofactor tetrahydrobiopterin (BH4), crucial for the function of aromatic amino acid hydroxylases, and as a dimerization cofactor of transcription factors HNF1A and HNF1B, important in liver and pancreas development and function. PCBD1 is expressed in the developing pancreas. The calculated molecular weight of PCBD1 is 12 kDa (PMID: 24204001, 24848070).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8331 Product name: Recombinant human PCBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC006324 Sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Predict reactive species\nFull Name: pterin-4 alpha-carbinolamine dehydratase\/dimerization cofactor of hepatocyte nuclear factor 1 alpha\nCalculated Molecular Weight: 104 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC006324\nGene Symbol: PCBD1\nGene ID (NCBI): 5092\nRRID: AB_2267945\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61457\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887751549097,"sku":"15702-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15702-1-ap","provider":"Iright","version":"1.0","type":"link"}