{"product_id":"proteintech-15728-1-ap","title":"Proteintech, 15728-1-AP, NDUFS7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFS7 (15728-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFS7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15728-1-AP targets NDUFS7 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human brain tissue,  Hela cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFS7(NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial) protein is one of the most conserved subunits of mitochondrial respiratory chain complex I and plays a central role in the interaction with the electron acceptor ubiquinone and in the proton-translocating mechanism(PMID:15269216).Defects in NDUFS7 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8471 Product name: Recombinant human NDUFS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC005954 Sequence: MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)\nCalculated Molecular Weight: 213 aa, 24 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC005954\nGene Symbol: NDUFS7\nGene ID (NCBI): 374291\nRRID: AB_2149029\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75251\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868894318761,"sku":"15728-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15728-1-ap","provider":"Iright","version":"1.0","type":"link"}