{"product_id":"proteintech-15732-1-ap","title":"Proteintech, 15732-1-AP, HSPB11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPB11 (15732-1-AP) by Proteintech is a Polyclonal antibody targeting HSPB11 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15732-1-AP targets HSPB11 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPB11 (Heat shock protein beta-11), also known as IFT25, was originally identified as a small heat shock protein. Recently it has been identified as a component of IFT complex B. It has been demonstrated that IFT25 is not required for ciliary assembly but is required for proper Hedgehog signaling, which in mammals occurs within cilia. Cilia lacking IFT25 have defects in the signal-dependent transport of multiple Hedgehog components and fail to activate the pathway upon stimulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8490 Product name: Recombinant human HSPB11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC005245 Sequence: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS Predict reactive species\nFull Name: heat shock protein family B (small), member 11\nCalculated Molecular Weight: 144 aa, 16 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC005245\nGene Symbol: HSPB11\nGene ID (NCBI): 51668\nRRID: AB_2279933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y547\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879114409,"sku":"15732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15732-1-ap","provider":"Iright","version":"1.0","type":"link"}