{"product_id":"proteintech-15760-1-ap","title":"Proteintech, 15760-1-AP, Neudesin\/NENF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Neudesin\/NENF (15760-1-AP) by Proteintech is a Polyclonal antibody targeting Neudesin\/NENF in WB, ELISA applications with reactivity to human samples\n15760-1-AP targets Neudesin\/NENF in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293 cells,  HeLa cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeudesin neurotrophic factor (NENF, also known as CIR2, SPUF, and SCIRP10) acts as a neurotrophic factor in postnatal mature neurons enhancing neuronal survival, which is localized to mitochondria and endoplasmic reticulum by PINK1 and PARK7 (PMID: 31536960). NENF in the adult brain is expected to play roles in the maintenance and protection of neurons in an autocrine\/paracrine manner (PMID: 15605373). It greatly increases cAMP levels in neural precursor cells and might activate a Gs-protein-coupled receptor that could activate the MAPK, PKA, and PI-3K signal pathways (PMID: 16547973).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8387 Product name: Recombinant human NENF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-172 aa of BC008823 Sequence: QTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF Predict reactive species\nFull Name: neuron derived neurotrophic factor\nCalculated Molecular Weight: 172 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC008823\nGene Symbol: NENF\nGene ID (NCBI): 29937\nRRID: AB_2150989\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UMX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843397289,"sku":"15760-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15760-1-ap","provider":"Iright","version":"1.0","type":"link"}