{"product_id":"proteintech-15774-1-ap","title":"Proteintech, 15774-1-AP, RAB3B\/C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB3B\/C (15774-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3B\/C in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n15774-1-AP targets RAB3B\/C in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  U-251 cells,  rat brain tissue\nPositive IHC detected in: rat brain tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8441 Product name: Recombinant human RAB3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC005035 Sequence: MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC Predict reactive species\nFull Name: RAB3B, member RAS oncogene family\nCalculated Molecular Weight: 219 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC005035\nGene Symbol: RAB3B\nGene ID (NCBI): 5865\nRRID: AB_2177414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20337\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987412649,"sku":"15774-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15774-1-ap","provider":"Iright","version":"1.0","type":"link"}