{"product_id":"proteintech-15778-1-ap","title":"Proteintech, 15778-1-AP, ENY2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENY2 (15778-1-AP) by Proteintech is a Polyclonal antibody targeting ENY2 in WB, IHC, ELISA applications with reactivity to human samples\n15778-1-AP targets ENY2 in WB, IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENY2, also named as DC6, is involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. It is required for nuclear receptor-mediated transactivation. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). The MW of ENY2 is about 10 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8462 Product name: Recombinant human ENY2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC007870 Sequence: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL Predict reactive species\nFull Name: enhancer of yellow 2 homolog (Drosophila)\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC007870\nGene Symbol: ENY2\nGene ID (NCBI): 56943\nRRID: AB_2878184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPA8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869679046825,"sku":"15778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15778-1-ap","provider":"Iright","version":"1.0","type":"link"}