{"product_id":"proteintech-15814-1-ap","title":"Proteintech, 15814-1-AP, MYL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL1 (15814-1-AP) by Proteintech is a Polyclonal antibody targeting MYL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15814-1-AP targets MYL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue,  human heart tissue,  mouse heart tissue,  mouse skeletal muscle tissue,  mouse skin tissue\nPositive IHC detected in: rat skeletal muscle tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8594 Product name: Recombinant human MYL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC005318 Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI Predict reactive species\nFull Name: myosin, light chain 1, alkali; skeletal, fast\nCalculated Molecular Weight: 150aa,17 kDa; 194aa,22 kDa\nObserved Molecular Weight: 14-17 kDa, 22-25 kDa\nGenBank Accession Number: BC005318\nGene Symbol: MYL1\nGene ID (NCBI): 4632\nRRID: AB_2266747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05976\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869563506857,"sku":"15814-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15814-1-ap","provider":"Iright","version":"1.0","type":"link"}