{"product_id":"proteintech-15845-1-ap","title":"Proteintech, 15845-1-AP, Pancreatic alpha-amylase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pancreatic alpha-amylase (15845-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic alpha-amylase in WB, IHC, ELISA applications with reactivity to human, mouse samples\n15845-1-AP targets Pancreatic alpha-amylase in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  mouse pancreas tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe complete human amylase gene contains five intact genes: two pancreatic genes (AMY2A and AMY2B) and three salivary genes (AMYIA, AMYIB, and AMYIC). AMY2A(Pancreatic alpha-amylase)is also named as PA and is a 56 kDa protein consisting of 496 amino acids in a single polypeptide chain, folded into three domains(PMID:10657258).AMY2A and AMY2B transcripts are present in the human pancreas but not in the parotid salivary gland, while AMY1 transcripts are present in the parotid gland but not in the pancreas(PMID:1692956). 15845-1-AP can recognize both AMY1 and AMY2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8605 Product name: Recombinant human AMY2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-511 aa of BC007060 Sequence: DIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species\nFull Name: amylase, alpha 2A (pancreatic)\nCalculated Molecular Weight: 511 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC007060\nGene Symbol: Amylase Alpha\nGene ID (NCBI): 279\nRRID: AB_2242664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04746\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869570158761,"sku":"15845-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15845-1-ap","provider":"Iright","version":"1.0","type":"link"}