{"product_id":"proteintech-15853-1-ap","title":"Proteintech, 15853-1-AP, FXYD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FXYD3 (15853-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15853-1-AP targets FXYD3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells,  A375 cells,  SGC-7901 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human breast cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFXYD3 (also known as Mat-8) is one of the seven members of Fxyd3 protein family, belonging to a small molecular auxiliary subunit with single transmembrane, and its extracellular segment contains conservative Fxyd3 sequence motifs. By combining the α\/β catalytic core of Na\/K-ATPase, this family can finely adjust the ionic affinity and kinetics of the pump in different tissues, cell types and physiological states, without affecting the overall expression of the enzyme. It is mainly expressed in stomach, colon, pancreas, prostate, skin and other epithelium, showing obvious tissue specificity, and is significantly up-regulated in breast cancer, pancreatic cancer, colorectal cancer, prostate cancer, renal cell cancer, cholangiocarcinoma and psoriasis lesions, and is related to disease progression and chemotherapy resistance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8672 Product name: Recombinant human FXYD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC005238 Sequence: MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 3\nCalculated Molecular Weight: 87 aa, 9 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC005238\nGene Symbol: FXYD3\nGene ID (NCBI): 5349\nRRID: AB_2108602\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14802\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644659881,"sku":"15853-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15853-1-ap","provider":"Iright","version":"1.0","type":"link"}