{"product_id":"proteintech-15867-1-ap","title":"Proteintech, 15867-1-AP, THYN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe THYN1 (15867-1-AP) by Proteintech is a Polyclonal antibody targeting THYN1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15867-1-AP targets THYN1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  mouse lung tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHYN1, also named as THY28, is a 28-32 kDa protein which located mainly in the nucleus. It appears to correlate with induction of apoptosis. (PMID:14601557)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8481 Product name: Recombinant human THYN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC006978 Sequence: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILF Predict reactive species\nFull Name: thymocyte nuclear protein 1\nCalculated Molecular Weight: 225aa,26 kDa; 166aa,19 kDa\nObserved Molecular Weight: 28-32 kDa\nGenBank Accession Number: BC006978\nGene Symbol: THYN1\nGene ID (NCBI): 29087\nRRID: AB_2287179\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P016\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887827669161,"sku":"15867-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15867-1-ap","provider":"Iright","version":"1.0","type":"link"}