{"product_id":"proteintech-15873-1-ap","title":"Proteintech, 15873-1-AP, PLN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLN (15873-1-AP) by Proteintech is a Polyclonal antibody targeting PLN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15873-1-AP targets PLN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhospholamban (PLN) is a 52-amino-acid transmembrane protein found in the sarcoplasmic reticulum (SR) of cardiac muscle cells. It has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. Phospholamban has a homopentamer form(25-27 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8632 Product name: Recombinant human PLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC005269 Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL Predict reactive species\nFull Name: phospholamban\nCalculated Molecular Weight: 52 aa, 6 kDa\nObserved Molecular Weight: 10 kDa, 25 kDa\nGenBank Accession Number: BC005269\nGene Symbol: PLN\nGene ID (NCBI): 5350\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P26678\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887766294697,"sku":"15873-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15873-1-ap","provider":"Iright","version":"1.0","type":"link"}