{"product_id":"proteintech-15877-1-ap","title":"Proteintech, 15877-1-AP, Centrin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Centrin 2 (15877-1-AP) by Proteintech is a Polyclonal antibody targeting Centrin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15877-1-AP targets Centrin 2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCentrin 2 is also named  as CALT, or CEN2. It plays a fundamental role in microtubule-organizing center structure and function. Oxidizing radiation induces polymerization of centrin 2 into dimers, tetramers, hexamers,and even higher molecular mass species, as a function of the radiation dose(PMID:17603931).It exsits as a 21-kD polypeptide specifically localized to the centrosome of interphase and mitotic cells in both HeLa and BHK cells (PMID:8248209).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8638 Product name: Recombinant human Centrin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC005334 Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY Predict reactive species\nFull Name: centrin, EF-hand protein, 2\nCalculated Molecular Weight: 172 aa, 20 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC005334\nGene Symbol: Centrin 2\nGene ID (NCBI): 1069\nRRID: AB_2077383\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41208\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901036201,"sku":"15877-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15877-1-ap","provider":"Iright","version":"1.0","type":"link"}