{"product_id":"proteintech-15880-1-ap","title":"Proteintech, 15880-1-AP, TDO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TDO2 (15880-1-AP) by Proteintech is a Polyclonal antibody targeting TDO2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15880-1-AP targets TDO2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTDO2 (tryptophan 2,3-dioxygenase), IDO1 (indoleamine 2,3-dioxygenase 1) and IDO2 are three enzymes that catalyze the amino acid tryptophan into kynurenine in the kynurenine pathway (PMID: 23090118, 28469468). TDO2 plays an important role in neurological diseases such as Alzheimer's disease, Parkinson's disease and autism. Overexpression of TDO2 promoted tumor cell survival and was correlated with tumor grade and poor prognosis in triple negative breast cancer, brain tumors and esophageal squamous cell carcinoma. TDO2 may be a potential therapeutic target in some cancers. (PMID: 21976023, 30134247)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8642 Product name: Recombinant human TDO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 55-406 aa of BC005355 Sequence: QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD Predict reactive species\nFull Name: tryptophan 2,3-dioxygenase\nCalculated Molecular Weight: 406 aa, 48 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC005355\nGene Symbol: TDO2\nGene ID (NCBI): 6999\nRRID: AB_2827610\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48775\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868846805161,"sku":"15880-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15880-1-ap","provider":"Iright","version":"1.0","type":"link"}