{"product_id":"proteintech-15890-1-ap","title":"Proteintech, 15890-1-AP, INPP4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INPP4B (15890-1-AP) by Proteintech is a Polyclonal antibody targeting INPP4B in WB, IHC, ELISA applications with reactivity to human samples\n15890-1-AP targets INPP4B in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINPP4B (Inositol polyphosphate 4-phosphatase type II) can catalyze the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PMID: 24070612; 24591580). It also Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PMID: 24591580).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8676 Product name: Recombinant human INPP4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC005273 Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD Predict reactive species\nFull Name: inositol polyphosphate-4-phosphatase, type II, 105kDa\nCalculated Molecular Weight: 53 aa, 6 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC005273\nGene Symbol: INPP4B\nGene ID (NCBI): 8821\nRRID: AB_3669224\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15327\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887684571305,"sku":"15890-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15890-1-ap","provider":"Iright","version":"1.0","type":"link"}