{"product_id":"proteintech-15891-1-ap","title":"Proteintech, 15891-1-AP, CKM\/CKB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CKM\/CKB (15891-1-AP) by Proteintech is a Polyclonal antibody targeting CKM\/CKB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15891-1-AP targets CKM\/CKB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue,  mouse brain tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCreatine Kinase, an enzyme important for energy metabolism in cells of high and fluctuating energy requirements, catalyses the reversible transfer of a phosphoryl goup from phosphocreatine to ADP. CK isoenzymes(muscle, brain, sarcomeric, Ubiquitous-type) play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Inactivation of creatine kinase by gliotoxin was accompanied by the formation of a 37-kDa form of the enzyme.This oxidized form of creatine kinase was rapidly reconverted to the 42-kDa species by the addition of reducing agents concomitant with restoration of activity.(PMID: 10827185). This antibody can recognize both CKB and CKM due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8678 Product name: Recombinant human CKM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC007462 Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK Predict reactive species\nFull Name: creatine kinase, muscle\nCalculated Molecular Weight: 381 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC007462\nGene Symbol: CKM\nGene ID (NCBI): 1158\nRRID: AB_2260647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06732\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869453209769,"sku":"15891-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15891-1-ap","provider":"Iright","version":"1.0","type":"link"}