{"product_id":"proteintech-15962-1-ap","title":"Proteintech, 15962-1-AP, Cystatin A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cystatin A (15962-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n15962-1-AP targets Cystatin A in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva tissue, NIH\/3T3 cells,  A549 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCystatin A (CSTA) is a member of the cystatin superfamily, which are thiol proteinase inhibitors (TPI) that play crucial roles in regulating proteolytic activity. It is a small protein composed of 98 amino acids with a molecular weight of approximately 11 kDa. CSTA is primarily expressed in epithelial tissues, such as the skin and esophagus, where it serves as a precursor protein for the cornified cell envelope in keratinocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8733 Product name: Recombinant human CSTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC010379 Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Predict reactive species\nFull Name: cystatin A (stefin A)\nCalculated Molecular Weight: 98 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC010379\nGene Symbol: Cystatin A\nGene ID (NCBI): 1475\nRRID: AB_10641043\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01040\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869402091689,"sku":"15962-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15962-1-ap","provider":"Iright","version":"1.0","type":"link"}