{"product_id":"proteintech-15969-1-ap","title":"Proteintech, 15969-1-AP, SDCCAG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SDCCAG3 (15969-1-AP) by Proteintech is a Polyclonal antibody targeting SDCCAG3 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n15969-1-AP targets SDCCAG3 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSDCCAG3, also named as NY-CO-3, is identified as serologically defined colon cancer antigen-3. It is an endosomal protein which is involved in the regulation of cytokinesis. SDCCAG3 is involved in modulation of TNF response. This gene has four isoforms with MW 40-50 kDa. Observed MW this protein is 48-60 kDa  may due to phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8745 Product name: Recombinant human SDCCAG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-412 aa of BC014515 Sequence: LGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDGEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEIKDEEEDS Predict reactive species\nFull Name: serologically defined colon cancer antigen 3\nCalculated Molecular Weight: 412 aa, 46 kDa\nObserved Molecular Weight: 48-60 kDa\nGenBank Accession Number: BC014515\nGene Symbol: SDCCAG3\nGene ID (NCBI): 10807\nRRID: AB_2183415\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96C92\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936655017,"sku":"15969-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15969-1-ap","provider":"Iright","version":"1.0","type":"link"}