{"product_id":"proteintech-15974-1-ap","title":"Proteintech, 15974-1-AP, ERH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERH (15974-1-AP) by Proteintech is a Polyclonal antibody targeting ERH in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n15974-1-AP targets ERH in WB, IF, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse testis tissue,  rat liver tissue,  rat testis tissue\nPositive IHC detected in: mouse testis tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8761 Product name: Recombinant human ERH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC014301 Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK Predict reactive species\nFull Name: enhancer of rudimentary homolog (Drosophila)\nCalculated Molecular Weight: 104 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC014301\nGene Symbol: ERH\nGene ID (NCBI): 2079\nRRID: AB_2098556\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P84090\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869679702185,"sku":"15974-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15974-1-ap","provider":"Iright","version":"1.0","type":"link"}