{"product_id":"proteintech-16000-1-ap","title":"Proteintech, 16000-1-AP, FGL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGL1 (16000-1-AP) by Proteintech is a Polyclonal antibody targeting FGL1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16000-1-AP targets FGL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, human liver tissue,  HepG2 cells,  mouse thymus tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissue, human hepatocirrhosis tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGL1 is a 68 kDa protein that comprises two disulfide linked 34 kDa homodimers. FGL1 is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8581 Product name: Recombinant human FGL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC007047 Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI Predict reactive species\nFull Name: fibrinogen-like 1\nCalculated Molecular Weight: 312 aa, 36 kDa\nObserved Molecular Weight: 34 kDa, 68 kDa\nGenBank Accession Number: BC007047\nGene Symbol: FGL1\nGene ID (NCBI): 2267\nRRID: AB_2103936\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876394665,"sku":"16000-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16000-1-ap","provider":"Iright","version":"1.0","type":"link"}