{"product_id":"proteintech-16011-1-ap","title":"Proteintech, 16011-1-AP, CYFIP1\/2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYFIP1\/2 (16011-1-AP) by Proteintech is a Polyclonal antibody targeting CYFIP1\/2 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n16011-1-AP targets CYFIP1\/2 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human gliomas tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYFIP1\/2 belongs to the CYFIP family and is involved in T-cell adhesion and p53-dependent induction of apoptosis. CYFIP1 contains 1,253 amino acids and shares 88% sequence identity with CYFIP2. CYFIP1 and CYFIP2 are members of a highly conserved protein family and share approximately 99% sequence identity with their mouse orthologs. CYFIP1 has been shown to interact with the small GTPase RAC1, which is implicated in development and maintenance of neuronal structures. Consistent with FMRP and RAC1 localization in dendritic fine structures, CYFIP1\/2 are present in synaptosomal extracts. This antibody can recognize both CYFIP1 and CYFIP2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8749 Product name: Recombinant human CYFIP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 855-1253 aa of BC011762 Sequence: CYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC Predict reactive species\nFull Name: cytoplasmic FMR1 interacting protein 2\nCalculated Molecular Weight: 148 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC011762\nGene Symbol: CYFIP2\nGene ID (NCBI): 26999\nRRID: AB_2090638\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96F07\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869455274153,"sku":"16011-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16011-1-ap","provider":"Iright","version":"1.0","type":"link"}