{"product_id":"proteintech-16015-1-ap","title":"Proteintech, 16015-1-AP, MMS19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMS19 (16015-1-AP) by Proteintech is a Polyclonal antibody targeting MMS19 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16015-1-AP targets MMS19 in WB, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human brain tissue,  PC-3 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMS19 plays a critical role in the biogenesis of multiple Fe-S proteins, which functions in genomic stability, RNA polymerase II function, and telomere length regulation. MMS19 has a alanine- and leucine-rich N terminus. It possible has a role in nucleotide excision repair(NER) and RNA polymerase II(POL II) transcription by interacting with ERCC2\/XPB helicases, both subunits of NER-transcription factor TFIIH. Also MMS19 involves in the regulation of ER. It can function in chromosome segregation by acting as a part of the mitotic spindle-associated MMXD complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8792 Product name: Recombinant human MMS19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 457-803 aa of BC006575 Sequence: FLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLDSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS Predict reactive species\nFull Name: MMS19 nucleotide excision repair homolog (S. cerevisiae)\nCalculated Molecular Weight: 1030 aa, 113 kDa\nObserved Molecular Weight: 103-113 kDa\nGenBank Accession Number: BC006575\nGene Symbol: MMS19\nGene ID (NCBI): 64210\nRRID: AB_2145043\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96T76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868885733545,"sku":"16015-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16015-1-ap","provider":"Iright","version":"1.0","type":"link"}