{"product_id":"proteintech-16016-1-ap","title":"Proteintech, 16016-1-AP, TXNDC4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXNDC4 (16016-1-AP) by Proteintech is a Polyclonal antibody targeting TXNDC4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n16016-1-AP targets TXNDC4 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  MCF-7 cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXNDC4 is also named as KIAA0573, ERP44, PDIA10, ERp44 and belongs to the thioredoxin family (TRX). It may be involved in electron transport, protein folding, response to unfolded protein, glycoprotein metabolism, secretory pathway. It may have a role in the control of oxidative protein folding in the endoplasmic reticulum.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8818 Product name: Recombinant human ERP44 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 57-406 aa of BC005374 Sequence: WCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL Predict reactive species\nFull Name: endoplasmic reticulum protein 44\nCalculated Molecular Weight: 406 aa, 47 kDa\nObserved Molecular Weight: 44-47 kDa\nGenBank Accession Number: BC005374\nGene Symbol: ERP44\nGene ID (NCBI): 23071\nRRID: AB_1640025\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BS26\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990918825,"sku":"16016-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16016-1-ap","provider":"Iright","version":"1.0","type":"link"}