{"product_id":"proteintech-16037-1-ap","title":"Proteintech, 16037-1-AP, NDUFB6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB6 (16037-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16037-1-AP targets NDUFB6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  MCF-7 cells,  mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB6, also named as NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 or Complex I-B17, is a 128 amino acid protein, which belongs to the complex I NDUFB6 subunit family. NDUFB6 localizes in the Mitochondrion inner membrane and is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8908 Product name: Recombinant human NDUFB6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC009801 Sequence: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa\nCalculated Molecular Weight: 128 aa, 15 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC009801\nGene Symbol: NDUFB6\nGene ID (NCBI): 4712\nRRID: AB_2235901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95139\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868919648425,"sku":"16037-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16037-1-ap","provider":"Iright","version":"1.0","type":"link"}