{"product_id":"proteintech-16041-1-ap","title":"Proteintech, 16041-1-AP, IFFO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFFO1 (16041-1-AP) by Proteintech is a Polyclonal antibody targeting IFFO1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16041-1-AP targets IFFO1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  human brain tissue,  mouse testis tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFFO1, also named as IFFO and Tumor antigen HOM-TES-103, is a member of the intermediate filament family which consists of primordial components of the cytoskeleton and nuclear envelope that are mainly distributed in the nucleus, followed by the cytoskeleton and cytoplasm. IFFO1 in the nucleus was identified to combine with both XRCC4 and the nuclear lamina protein lamin A\/C to be involved in nonhomologous DNA end joining (NHEJ). The expression of IFFO1 is associated with tumor progression. IFFO1 could be used as a potential marker to differentiate malignant ascites cell-free tumor DNA (cftDNA) of ovarian cancer from benign controls.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8915 Product name: Recombinant human IFFO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-294 aa of BC004384 Sequence: MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR Predict reactive species\nFull Name: intermediate filament family orphan 1\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 75-85 kDa\nGenBank Accession Number: BC004384\nGene Symbol: IFFO1\nGene ID (NCBI): 25900\nRRID: AB_2121676\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q0D2I5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869550137513,"sku":"16041-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16041-1-ap","provider":"Iright","version":"1.0","type":"link"}